| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) | 
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication  | 
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149  | 
| Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) | 
| Protein Protein phosphatase-1 (PP-1) [56311] (5 species) | 
| Species Human (Homo sapiens) [TaxId:9606] [188651] (2 PDB entries) | 
| Domain d3e7ba_: 3e7b A: [174711] automated match to d1fjma_ complexed with azi, cl, e7b, gol, mn, na  | 
PDB Entry: 3e7b (more details), 1.7 Å
SCOPe Domain Sequences for d3e7ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e7ba_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens) [TaxId: 9606]}
slnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
Timeline for d3e7ba_: