SCOPe 2.02: Domain d3e7ba_: 3e7b A:

Lineage for d3e7ba_ (3e7b A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188651] (2 PDB entries)

8. Domain d3e7ba_: 3e7b A: [174711]
   automated match to d1fjma_
   complexed with azi, cl, e7b, gol, mn, na

Details for d3e7ba_

PDB Entry: 3e7b, 1.7 Å

PDB Description: crystal structure of protein phosphatase-1 bound to the natural toxin inhibitor tautomycin

PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3e7ba_:

Sequence; same for both SEQRES and ATOM records:

>d3e7ba_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens) [TaxId: 9606]}
slnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

Timeline for d3e7ba_:

• d3e7ba_ first appeared in SCOPe 2.01
  
• d3e7ba_ appears in SCOPe 2.03
  
• d3e7ba_ appears in the current release, SCOPe 2.08, called d3e7ba1