Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Non-hem ferritin [63524] (7 species) |
Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries) |
Domain d3e6sb_: 3e6s B: [174702] automated match to d1vlga_ complexed with fe, so4 |
PDB Entry: 3e6s (more details), 1.95 Å
SCOPe Domain Sequences for d3e6sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e6sb_ a.25.1.1 (B:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]} seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl npfhlqqvneedkigsilakvtdenrtpgllrsldvvs
Timeline for d3e6sb_: