SCOP 1.67: Domain d1mjoc_: 1mjo C:

Lineage for d1mjoc_ (1mjo C:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (4 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)

6. Protein Met repressor, MetJ (MetR) [47607] (1 species)

7. Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)

8. Domain d1mjoc_: 1mjo C: [17468]

Details for d1mjoc_

PDB Entry: 1mjo, 2.1 Å

PDB Description: methionine holorepressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to the minimal met consensus operator with the central ta step mutated to at

SCOP Domain Sequences for d1mjoc_:

Sequence; same for both SEQRES and ATOM records:

>d1mjoc_ a.43.1.5 (C:) Met repressor, MetJ (MetR) {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

Timeline for d1mjoc_:

• d1mjoc_ first appeared (with stable ids) in SCOP 1.55
  
• d1mjoc_ appears in SCOP 1.65
  
• d1mjoc_ appears in SCOP 1.69
  
• d1mjoc_ appears in the current release, SCOPe 2.08