Lineage for d1mjoc_ (1mjo C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712706Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
    automatically mapped to Pfam PF01340
  6. 2712707Protein Met repressor, MetJ (MetR) [47607] (1 species)
  7. 2712708Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. 2712715Domain d1mjoc_: 1mjo C: [17468]
    protein/DNA complex; complexed with ca, sam; mutant

Details for d1mjoc_

PDB Entry: 1mjo (more details), 2.1 Å

PDB Description: methionine holorepressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to the minimal met consensus operator with the central ta step mutated to at
PDB Compounds: (C:) methionine repressor

SCOPe Domain Sequences for d1mjoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjoc_ a.43.1.5 (C:) Met repressor, MetJ (MetR) {Escherichia coli [TaxId: 562]}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOPe Domain Coordinates for d1mjoc_:

Click to download the PDB-style file with coordinates for d1mjoc_.
(The format of our PDB-style files is described here.)

Timeline for d1mjoc_: