SCOPe 2.06: Domain d1mntb_: 1mnt B:

Lineage for d1mntb_ (1mnt B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)

6. Protein Mnt repressor [47602] (1 species)

7. Species Salmonella bacteriophage P22 [TaxId:10754] [47603] (1 PDB entry)

8. Domain d1mntb_: 1mnt B: [17454]
   includes 15 residues common with the tetramerization domain

Details for d1mntb_

PDB Entry: 1mnt

PDB Description: solution structure of dimeric mnt repressor (1-76)

PDB Compounds: (B:) mnt repressor

SCOPe Domain Sequences for d1mntb_:

Sequence; same for both SEQRES and ATOM records:

>d1mntb_ a.43.1.1 (B:) Mnt repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
arddphfnfrmpmevreklkfraeangrsmnsellqivqdalskpspvtgyrndaerlad
eqselv

Timeline for d1mntb_:

• d1mntb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mntb_ appears in SCOPe 2.05
  
• d1mntb_ appears in SCOPe 2.07
  
• d1mntb_ appears in the current release, SCOPe 2.08