Lineage for d1mntb_ (1mnt B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3582Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 3583Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 3584Family a.43.1.1: Phage repressors [47599] (2 proteins)
  6. 3619Protein Mnt repressor [47602] (1 species)
  7. 3620Species Salmonella bacteriophage p22 [TaxId:10754] [47603] (1 PDB entry)
  8. 3622Domain d1mntb_: 1mnt B: [17454]

Details for d1mntb_

PDB Entry: 1mnt (more details)

PDB Description: solution structure of dimeric mnt repressor (1-76)

SCOP Domain Sequences for d1mntb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mntb_ a.43.1.1 (B:) Mnt repressor {Salmonella bacteriophage p22}
arddphfnfrmpmevreklkfraeangrsmnsellqivqdalskpspvtgyrndaerlad
eqselv

SCOP Domain Coordinates for d1mntb_:

Click to download the PDB-style file with coordinates for d1mntb_.
(The format of our PDB-style files is described here.)

Timeline for d1mntb_:

3622
d1mntb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1mnta_