![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins) |
![]() | Protein Arc repressor [47600] (1 species) |
![]() | Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries) |
![]() | Domain d1arrb_: 1arr B: [17450] |
PDB Entry: 1arr (more details)
SCOPe Domain Sequences for d1arrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1arrb_ a.43.1.1 (B:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]} mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
Timeline for d1arrb_: