PDB entry 1arr

View 1arr on RCSB PDB site
Description: relaxation matrix refinement of the solution structure of the arc repressor
Class: gene-regulating protein
Keywords: gene-regulating protein
Deposited on 1993-08-24, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arc repressor
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1arra_
  • Chain 'B':
    Compound: arc repressor
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1arrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1arrA (A:)
    mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1arrB (B:)
    mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegriga