SCOPe 2.06: Domain d3e0ua_: 3e0u A:

Lineage for d3e0ua_ (3e0u A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [188882] (2 PDB entries)

8. Domain d3e0ua_: 3e0u A: [174444]
   automated match to d1gp1a_
   complexed with gol, nh4

Details for d3e0ua_

PDB Entry: 3e0u, 2.3 Å

PDB Description: Crystal structure of T. cruzi GPX1

PDB Compounds: (A:) glutathione peroxidase

SCOPe Domain Sequences for d3e0ua_:

Sequence, based on SEQRES records:

>d3e0ua_ c.47.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ksiyefqvnaadgkpydlsqhkghplliynvasrcgytkggyetattlynkykgqgftvl
afpcnqfagqepgtalevkefactrfkadfpimakidvngskahplyefmkatipglfgt
kaikwnftsflidrhgvpverfspgasvediekkllpllggari

Sequence, based on observed residues (ATOM records):

>d3e0ua_ c.47.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ksiyefqvnaadgkpydlsqhkghplliynvasrcgytkggyetattlynkykgqgftvl
afpcnqfagfactrfkadfpimakidvngskahplyefmkatipglfgtkaikwnftsfl
idrhgvpverfspgasvediekkllpllggari

Timeline for d3e0ua_:

• d3e0ua_ first appeared in SCOPe 2.01
  
• d3e0ua_ appears in SCOPe 2.05
  
• d3e0ua_ appears in SCOPe 2.07
  
• d3e0ua_ appears in the current release, SCOPe 2.08