Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Glutathione peroxidase [52902] (2 species) contains many insertions in the common fold |
Species Cow (Bos taurus) [TaxId:9913] [52903] (1 PDB entry) |
Domain d1gp1a_: 1gp1 A: [33059] |
PDB Entry: 1gp1 (more details), 2 Å
SCOPe Domain Sequences for d1gp1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gp1a_ c.47.1.10 (A:) Glutathione peroxidase {Cow (Bos taurus) [TaxId: 9913]} rtvyafsarplaggepfnlsslrgkvllienvaslxgttvrdytqmndlqrrlgprglvv lgfpcnqfghqenakneeilnclkyvrpgggfepnfmlfekcevngekahplfaflrevl ptpsddatalmtdpkfitwspvcrndvswnfekflvgpdgvpvrrysrrfltidiepdie tllsq
Timeline for d1gp1a_: