Lineage for d1gp1a_ (1gp1 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) 
Protein Glutathione peroxidase [52902] (2 species)
contains many insertions in the common fold
Species Cow (Bos taurus) [TaxId:9913] [52903] (1 PDB entry) 
Domain d1gp1a_: 1gp1 A: [33059]
Details for d1gp1a_
PDB Entry: 1gp1 (more details), 2 Å
PDB Description: the refined structure of the selenoenzyme glutathione peroxidase at 0.2-nm resolution
PDB Compounds: (A:) glutathione peroxidaseSCOPe Domain Sequences for d1gp1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gp1a_ c.47.1.10 (A:) Glutathione peroxidase {Cow (Bos taurus) [TaxId: 9913]}
rtvyafsarplaggepfnlsslrgkvllienvaslxgttvrdytqmndlqrrlgprglvv
lgfpcnqfghqenakneeilnclkyvrpgggfepnfmlfekcevngekahplfaflrevl
ptpsddatalmtdpkfitwspvcrndvswnfekflvgpdgvpvrrysrrfltidiepdie
tllsq
SCOPe Domain Coordinates for d1gp1a_:
Click to download the PDB-style file with coordinates for d1gp1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gp1a_:
- d1gp1a_ first appeared (with stable ids) in SCOP 1.55
- d1gp1a_ appears in SCOPe 2.05
- d1gp1a_ appears in SCOPe 2.07
- d1gp1a_ appears in the current release, SCOPe 2.08
View in 3D
