Lineage for d3dy3z_ (3dy3 Z:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2226430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2226866Domain d3dy3z_: 3dy3 Z: [174361]
    Other proteins in same PDB: d3dy3a_, d3dy3b_, d3dy3c_, d3dy3e_, d3dy3f_, d3dy3g_, d3dy3o_, d3dy3p_, d3dy3q_, d3dy3s_, d3dy3t_, d3dy3u_
    automated match to d1g0ul_
    complexed with slr

Details for d3dy3z_

PDB Entry: 3dy3 (more details), 2.81 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with the epimer form of spirolactacystin
PDB Compounds: (Z:) Proteasome component C5

SCOPe Domain Sequences for d3dy3z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dy3z_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d3dy3z_:

Click to download the PDB-style file with coordinates for d3dy3z_.
(The format of our PDB-style files is described here.)

Timeline for d3dy3z_: