Lineage for d3dukb_ (3duk B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020659Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1020660Protein automated matches [190205] (10 species)
    not a true protein
  7. 1020672Species Methylobacillus flagellatus [TaxId:265072] [188697] (1 PDB entry)
  8. 1020674Domain d3dukb_: 3duk B: [174239]
    automated match to d3blza1
    complexed with cl, edo

Details for d3dukb_

PDB Entry: 3duk (more details), 2.2 Å

PDB Description: crystal structure of a ntf2-like protein of unknown function (mfla_0564) from methylobacillus flagellatus kt at 2.200 a resolution
PDB Compounds: (B:) NTF2-like protein of unknown function

SCOPe Domain Sequences for d3dukb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dukb_ d.17.4.0 (B:) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
gmsvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdl
ydwhnsngpaknvqsritnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkv
fhlha

SCOPe Domain Coordinates for d3dukb_:

Click to download the PDB-style file with coordinates for d3dukb_.
(The format of our PDB-style files is described here.)

Timeline for d3dukb_: