| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
| Protein automated matches [190205] (10 species) not a true protein |
| Species Methylobacillus flagellatus [TaxId:265072] [188697] (1 PDB entry) |
| Domain d3duka_: 3duk A: [174238] automated match to d3blza1 complexed with cl, edo |
PDB Entry: 3duk (more details), 2.2 Å
SCOPe Domain Sequences for d3duka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3duka_ d.17.4.0 (A:) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
gmsvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdl
ydwhnsngpaknvqsritnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkv
fhlha
Timeline for d3duka_: