SCOPe 2.01: Domain d3duka_: 3duk A:

Lineage for d3duka_ (3duk A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (10 species)
   not a true protein

7. Species Methylobacillus flagellatus [TaxId:265072] [188697] (1 PDB entry)

8. Domain d3duka_: 3duk A: [174238]
   automated match to d3blza1
   complexed with cl, edo

Details for d3duka_

PDB Entry: 3duk, 2.2 Å

PDB Description: crystal structure of a ntf2-like protein of unknown function (mfla_0564) from methylobacillus flagellatus kt at 2.200 a resolution

PDB Compounds: (A:) NTF2-like protein of unknown function

SCOPe Domain Sequences for d3duka_:

Sequence; same for both SEQRES and ATOM records:

>d3duka_ d.17.4.0 (A:) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
gmsvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdl
ydwhnsngpaknvqsritnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkv
fhlha

Timeline for d3duka_:

• d3duka_ is new in SCOPe 2.01-stable
  
• d3duka_ appears in SCOPe 2.02
  
• d3duka_ appears in the current release, SCOPe 2.08, called d3duka1