![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (12 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:90371] [188554] (2 PDB entries) |
![]() | Domain d3dr8b_: 3dr8 B: [174203] automated match to d2bl1a1 complexed with aco, act, cl |
PDB Entry: 3dr8 (more details), 1.95 Å
SCOPe Domain Sequences for d3dr8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dr8b_ d.108.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} namtirfadkadcaaiteiynhavlhtaaiwndrtvdtdnrlawyearqllgypvlvsee ngvvtgyasfgdwrsfdgfrytvehsvyvhpahqgkglgrkllsrlidearrcgkhvmva giesqnaasirlhhslgftvtaqmpqvgvkfgrwldltfmqlqldehaapdac
Timeline for d3dr8b_: