Lineage for d3dp3d_ (3dp3 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551122Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2551123Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2551124Species Helicobacter pylori [TaxId:210] [188573] (17 PDB entries)
  8. 2551140Domain d3dp3d_: 3dp3 D: [174138]
    automated match to d1u1za_
    complexed with 4bb, ben, cl

Details for d3dp3d_

PDB Entry: 3dp3 (more details), 2.3 Å

PDB Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Helicobacter pylori in complex with compound 3q
PDB Compounds: (D:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d3dp3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dp3d_ d.38.1.6 (D:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
hkgmiwqvggtaqvdgkvvaeaelkamiaer

SCOPe Domain Coordinates for d3dp3d_:

Click to download the PDB-style file with coordinates for d3dp3d_.
(The format of our PDB-style files is described here.)

Timeline for d3dp3d_: