Lineage for d3dgad_ (3dga D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1216602Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1216603Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 1216604Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1216843Protein automated matches [190469] (7 species)
    not a true protein
  7. 1216870Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188759] (2 PDB entries)
  8. 1216874Domain d3dgad_: 3dga D: [173921]
    automated match to d1j3ic_
    complexed with ndp, rj1, ump

Details for d3dgad_

PDB Entry: 3dga (more details), 2.7 Å

PDB Description: wild-type plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with rjf01302, nadph, and dump
PDB Compounds: (D:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3dgad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgad_ d.117.1.1 (D:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ddddeeeddfvyfnfnkekeeknknsihpndfqiynslkykyhpeyqylniiydimmngn
kqsdrtgvgvlskfgyimkfdlsqyfpllttkklflrgiieellwfirgetngntllnkn
vriweangtrefldnrklfhrevndlgpiygfqwrhfgaeytnmydnyenkgvdqlknii
nlikndptsrrillcawnvkdldqmalppchilcqfyvfdgklscimyqrscdlglgvpf
niasysifthmiaqvcnlqpaqfihvlgnahvynnhidslkiqlnripypfptlklnpdi
kniedftisdftiqnyvhhekismdm

SCOPe Domain Coordinates for d3dgad_:

Click to download the PDB-style file with coordinates for d3dgad_.
(The format of our PDB-style files is described here.)

Timeline for d3dgad_: