Class g: Small proteins [56992] (90 folds) |
Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
Superfamily g.43.1: B-box zinc-binding domain [57845] (1 family) |
Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins) |
Protein automated matches [190972] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188625] (2 PDB entries) |
Domain d3ddtb_: 3ddt B: [173848] automated match to d2d8ua1 complexed with zn |
PDB Entry: 3ddt (more details), 1.9 Å
SCOPe Domain Sequences for d3ddtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ddtb_ g.43.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplq
Timeline for d3ddtb_: