Lineage for d3ddtb_ (3ddt B:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1245780Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 1245781Superfamily g.43.1: B-box zinc-binding domain [57845] (1 family) (S)
  5. 1245782Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins)
  6. 1245805Protein automated matches [190972] (1 species)
    not a true protein
  7. 1245806Species Human (Homo sapiens) [TaxId:9606] [188625] (2 PDB entries)
  8. 1245808Domain d3ddtb_: 3ddt B: [173848]
    automated match to d2d8ua1
    complexed with zn

Details for d3ddtb_

PDB Entry: 3ddt (more details), 1.9 Å

PDB Description: Crystal structure of the B2 box from MuRF1 in dimeric state
PDB Compounds: (B:) E3 ubiquitin-protein ligase TRIM63

SCOPe Domain Sequences for d3ddtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ddtb_ g.43.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplq

SCOPe Domain Coordinates for d3ddtb_:

Click to download the PDB-style file with coordinates for d3ddtb_.
(The format of our PDB-style files is described here.)

Timeline for d3ddtb_: