PDB entry 3ddt

View 3ddt on RCSB PDB site
Description: Crystal structure of the B2 box from MuRF1 in dimeric state
Class: ligase
Keywords: zinc-binding motif, RING-like fold, Coiled coil, Cytoplasm, Ligase, Metal-binding, Muscle protein, Nucleus, Polymorphism, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on 2008-06-06, released 2008-10-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase TRIM63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969Q1 (3-47)
      • expression tag (0-2)
    Domains in SCOPe 2.02: d3ddta_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase TRIM63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969Q1 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.02: d3ddtb_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase TRIM63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3ddtc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ddtA (A:)
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplqs

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3ddtB (B:)
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplqs

    Sequence, based on observed residues (ATOM records): (download) 
    >3ddtB (B:)
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplq

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3ddtC (C:)
gamgshpmckehedekiniycltcevptcsmckvfgihkacevaplqs

    Sequence, based on observed residues (ATOM records): (download) 
    >3ddtC (C:)
gshpmckehedekiniycltcevptcsmckvfgihkacevaplq