SCOPe 2.07: Domain d1alvb_: 1alv B:

Lineage for d1alvb_ (1alv B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [47555] (7 PDB entries)

8. Domain d1alvb_: 1alv B: [17371]
   complexed with ca

Details for d1alvb_

PDB Entry: 1alv, 1.9 Å

PDB Description: calcium bound domain vi of porcine calpain

PDB Compounds: (B:) calpain

SCOPe Domain Sequences for d1alvb_:

Sequence; same for both SEQRES and ATOM records:

>d1alvb_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

Timeline for d1alvb_:

• d1alvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1alvb_ appears in SCOPe 2.06
  
• d1alvb_ appears in the current release, SCOPe 2.08