Lineage for d1alvb_ (1alv B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711466Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2711480Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 2711514Species Pig (Sus scrofa) [TaxId:9823] [47555] (7 PDB entries)
  8. 2711516Domain d1alvb_: 1alv B: [17371]
    complexed with ca

Details for d1alvb_

PDB Entry: 1alv (more details), 1.9 Å

PDB Description: calcium bound domain vi of porcine calpain
PDB Compounds: (B:) calpain

SCOPe Domain Sequences for d1alvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alvb_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d1alvb_:

Click to download the PDB-style file with coordinates for d1alvb_.
(The format of our PDB-style files is described here.)

Timeline for d1alvb_: