Lineage for d1f4ob_ (1f4o B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355183Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 355674Family a.39.1.8: Penta-EF-hand proteins [63550] (5 proteins)
  6. 355712Protein Grancalcin [47550] (1 species)
    Calpain small subunit homologue
  7. 355713Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)
  8. 355720Domain d1f4ob_: 1f4o B: [17363]
    complexed with ca

Details for d1f4ob_

PDB Entry: 1f4o (more details), 2.5 Å

PDB Description: crystal structure of grancalcin with bound calcium

SCOP Domain Sequences for d1f4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4ob_ a.39.1.8 (B:) Grancalcin {Human (Homo sapiens)}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai

SCOP Domain Coordinates for d1f4ob_:

Click to download the PDB-style file with coordinates for d1f4ob_.
(The format of our PDB-style files is described here.)

Timeline for d1f4ob_: