SCOP 1.67: Domain d1f4ob_: 1f4o B:

Lineage for d1f4ob_ (1f4o B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (5 proteins)

6. Protein Grancalcin [47550] (1 species)
   Calpain small subunit homologue

7. Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)

8. Domain d1f4ob_: 1f4o B: [17363]
   complexed with ca

Details for d1f4ob_

PDB Entry: 1f4o, 2.5 Å

PDB Description: crystal structure of grancalcin with bound calcium

SCOP Domain Sequences for d1f4ob_:

Sequence; same for both SEQRES and ATOM records:

>d1f4ob_ a.39.1.8 (B:) Grancalcin {Human (Homo sapiens)}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai

Timeline for d1f4ob_:

• d1f4ob_ first appeared (with stable ids) in SCOP 1.55
  
• d1f4ob_ appears in SCOP 1.65
  
• d1f4ob_ appears in SCOP 1.69
  
• d1f4ob_ appears in the current release, SCOPe 2.08