Lineage for d3d0aa_ (3d0a A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377723Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2377724Species Human (Homo sapiens) [TaxId:9606] [49420] (65 PDB entries)
  8. 2377776Domain d3d0aa_: 3d0a A: [173594]
    automated match to d1gzha_
    protein/DNA complex; protein/RNA complex; complexed with zn; mutant

Details for d3d0aa_

PDB Entry: 3d0a (more details), 1.8 Å

PDB Description: human p53 core domain with hot spot mutation r249s and second site suppressor mutation h168r in sequence-specific complex with dna
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d3d0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d0aa_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqrmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevrvc
acpgrdrrteeenlrk

SCOPe Domain Coordinates for d3d0aa_:

Click to download the PDB-style file with coordinates for d3d0aa_.
(The format of our PDB-style files is described here.)

Timeline for d3d0aa_: