Lineage for d1gzha_ (1gzh A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377723Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2377724Species Human (Homo sapiens) [TaxId:9606] [49420] (65 PDB entries)
  8. 2377861Domain d1gzha_: 1gzh A: [70807]
    Other proteins in same PDB: d1gzhb1, d1gzhb2, d1gzhd1, d1gzhd2
    complexed with so4, zn

Details for d1gzha_

PDB Entry: 1gzh (more details), 2.6 Å

PDB Description: Crystal structure of the BRCT domains of human 53BP1 bound to the p53 tumor supressor
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d1gzha_:

Sequence, based on SEQRES records: (download)

>d1gzha_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
svvvpyeppevgsecttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
cacpgrdrrteeenlrkk

Sequence, based on observed residues (ATOM records): (download)

>d1gzha_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercappqhlirveglrveylddrntfrhsvvvpye
ppecttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvcacpgrdrrte
eenlrkk

SCOPe Domain Coordinates for d1gzha_:

Click to download the PDB-style file with coordinates for d1gzha_.
(The format of our PDB-style files is described here.)

Timeline for d1gzha_: