Lineage for d3d02a_ (3d02 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913431Species Klebsiella pneumoniae [TaxId:272620] [188448] (2 PDB entries)
  8. 2913433Domain d3d02a_: 3d02 A: [173581]
    automated match to d1tjya_
    complexed with cl, gol

Details for d3d02a_

PDB Entry: 3d02 (more details), 1.3 Å

PDB Description: crystal structure of periplasmic sugar-binding protein (yp_001338366.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.30 a resolution
PDB Compounds: (A:) Putative LACI-type transcriptional regulator

SCOPe Domain Sequences for d3d02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d02a_ c.93.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ektvvniskvdgmpwfnrmgegvvqagkefnlnasqvgpsstdapqqvkiiedliarkvd
aitivpndanvlepvfkkardagivvltnespgqpsanwdveiidnekfaaeyvehmakr
mggkggyviyvgsltvpqhnlwadllvkyqkehypdmhevtrrmpvaesvddsrrttldl
mktypdlkavvsfgsngpigagravkekraknkvavygmmipsqaasliksgditegity
dpatagyalaavastllngktiepgfelkelgkaevdsdkhiirfhkvllvnkdnidsly

SCOPe Domain Coordinates for d3d02a_:

Click to download the PDB-style file with coordinates for d3d02a_.
(The format of our PDB-style files is described here.)

Timeline for d3d02a_: