SCOPe 2.01: Domain d3d02a_: 3d02 A:

Lineage for d3d02a_ (3d02 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (4 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [188448] (1 PDB entry)

8. Domain d3d02a_: 3d02 A: [173581]
   automated match to d1tjya_
   complexed with cl, gol

Details for d3d02a_

PDB Entry: 3d02, 1.3 Å

PDB Description: crystal structure of periplasmic sugar-binding protein (yp_001338366.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.30 a resolution

PDB Compounds: (A:) Putative LACI-type transcriptional regulator

SCOPe Domain Sequences for d3d02a_:

Sequence; same for both SEQRES and ATOM records:

>d3d02a_ c.93.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ektvvniskvdgmpwfnrmgegvvqagkefnlnasqvgpsstdapqqvkiiedliarkvd
aitivpndanvlepvfkkardagivvltnespgqpsanwdveiidnekfaaeyvehmakr
mggkggyviyvgsltvpqhnlwadllvkyqkehypdmhevtrrmpvaesvddsrrttldl
mktypdlkavvsfgsngpigagravkekraknkvavygmmipsqaasliksgditegity
dpatagyalaavastllngktiepgfelkelgkaevdsdkhiirfhkvllvnkdnidsly

Timeline for d3d02a_:

• d3d02a_ is new in SCOPe 2.01-stable
  
• d3d02a_ appears in SCOPe 2.02
  
• d3d02a_ appears in the current release, SCOPe 2.08