Lineage for d3cxia_ (3cxi A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015851Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (9 PDB entries)
    Uniprot Q8AXY1 17-138
  8. 2015855Domain d3cxia_: 3cxi A: [173528]
    automated match to d1pa0a_
    complexed with pe4, so4, vit

Details for d3cxia_

PDB Entry: 3cxi (more details), 1.83 Å

PDB Description: Structure of BthTX-I complexed with alpha-tocopherol
PDB Compounds: (A:) Myotoxic phospholipase A2-like

SCOPe Domain Sequences for d3cxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxia_ a.133.1.2 (A:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOPe Domain Coordinates for d3cxia_:

Click to download the PDB-style file with coordinates for d3cxia_.
(The format of our PDB-style files is described here.)

Timeline for d3cxia_: