SCOPe 2.06: Domain d3cxib_: 3cxi B:

Lineage for d3cxib_ (3cxi B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (9 PDB entries)
   Uniprot Q8AXY1 17-138

8. Domain d3cxib_: 3cxi B: [173529]
   automated match to d1pa0a_
   complexed with pe4, so4, vit

Details for d3cxib_

PDB Entry: 3cxi, 1.83 Å

PDB Description: Structure of BthTX-I complexed with alpha-tocopherol

PDB Compounds: (B:) Myotoxic phospholipase A2-like

SCOPe Domain Sequences for d3cxib_:

Sequence; same for both SEQRES and ATOM records:

>d3cxib_ a.133.1.2 (B:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

Timeline for d3cxib_:

• d3cxib_ first appeared in SCOPe 2.01
  
• d3cxib_ appears in SCOPe 2.05
  
• d3cxib_ appears in SCOPe 2.07
  
• d3cxib_ appears in the current release, SCOPe 2.08