Class g: Small proteins [56992] (100 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein BIR domains of XIAP [57928] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries) Uniprot P98170 241-356 |
Domain d3clxc_: 3clx C: [173319] automated match to d1f9xa_ complexed with x22, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3clx (more details), 2.7 Å
SCOPe Domain Sequences for d3clxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3clxc_ g.52.1.1 (C:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed pweqhakwypgckylleqkgqeyinnihlthsleeclv
Timeline for d3clxc_: