SCOPe 2.04: Domain d3clpc_: 3clp C:

Lineage for d3clpc_ (3clp C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Rhizobium loti [TaxId:381] [187243] (3 PDB entries)

8. Domain d3clpc_: 3clp C: [173316]
   automated match to d1vp6a_
   complexed with cmp; mutant

Details for d3clpc_

PDB Entry: 3clp, 2 Å

PDB Description: m. loti cyclic-nucleotide binding domain mutant 2

PDB Compounds: (C:) Mll3241 protein

SCOPe Domain Sequences for d3clpc_:

Sequence; same for both SEQRES and ATOM records:

>d3clpc_ b.82.3.2 (C:) automated matches {Rhizobium loti [TaxId: 381]}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgepesatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg

Timeline for d3clpc_:

• d3clpc_ first appeared in SCOPe 2.01
  
• d3clpc_ appears in SCOPe 2.03
  
• d3clpc_ appears in SCOPe 2.05
  
• d3clpc_ appears in the current release, SCOPe 2.08