Lineage for d3clpa_ (3clp A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1559475Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1559481Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1559622Protein automated matches [190352] (8 species)
    not a true protein
  7. 1559673Species Rhizobium loti [TaxId:381] [187243] (3 PDB entries)
  8. 1559674Domain d3clpa_: 3clp A: [173315]
    automated match to d1vp6a_
    complexed with cmp; mutant

Details for d3clpa_

PDB Entry: 3clp (more details), 2 Å

PDB Description: m. loti cyclic-nucleotide binding domain mutant 2
PDB Compounds: (A:) Mll3241 protein

SCOPe Domain Sequences for d3clpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3clpa_ b.82.3.2 (A:) automated matches {Rhizobium loti [TaxId: 381]}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgepesatvsaattvsllslhsadfqmlcssspei
aeifrktalerr

SCOPe Domain Coordinates for d3clpa_:

Click to download the PDB-style file with coordinates for d3clpa_.
(The format of our PDB-style files is described here.)

Timeline for d3clpa_: