SCOPe 2.08: Domain d3cdwa1: 3cdw A:1-462

Lineage for d3cdwa1 (3cdw A:1-462)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein automated matches [190260] (25 species)
   not a true protein

7. Species Coxsackievirus b3 [TaxId:103903] [188493] (5 PDB entries)

8. Domain d3cdwa1: 3cdw A:1-462 [173169]
   Other proteins in same PDB: d3cdwa2
   automated match to d1ra6a_
   protein/RNA complex; complexed with act, cl, gol, pop

Details for d3cdwa1

PDB Entry: 3cdw, 2.5 Å

PDB Description: Crystal structure of coxsackievirus B3 RNA-dependent RNA polymerase (3Dpol) in complex with protein primer VPg and a pyrophosphate

PDB Compounds: (A:) RNA-directed RNA polymerase 3D-POL

SCOPe Domain Sequences for d3cdwa1:

Sequence; same for both SEQRES and ATOM records:

>d3cdwa1 e.8.1.4 (A:1-462) automated matches {Coxsackievirus b3 [TaxId: 103903]}
geiefiesskdagfpvintpsktklepsvfhqvfegnkepavlrsgdprlkanfeeaifs
kyignvnthvdeymleavdhyagqlatldistepmkledavygteglealdlttsagypy
valgikkrdilskktkdltklkecmdkyglnlpmvtyvkdelrsiekvakgksrlieass
lndsvamrqtfgnlyktfhlnpgvvtgsavgcdpdlfwskipvmldghliafdysgydas
lspvwfaclkmlleklgythketnyidylcnshhlyrdkhyfvrggmpsgcsgtsifnsm
inniiirtlmlkvykgidldqfrmiaygddviasypwpidasllaeagkgyglimtpadk
gecfnevtwtnatflkryfradeqypflvhpvmpmkdihesirwtkdpkntqdhvrslcl
lawhngeheyeefirkirsvpvgrcltlpafstlrrkwldsf

Timeline for d3cdwa1:

• d3cdwa1 first appeared in SCOPe 2.01, called d3cdwa_
  
• d3cdwa1 appears in SCOPe 2.07