Lineage for d3c73b_ (3c73 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169030Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1169352Protein automated matches [190100] (10 species)
    not a true protein
  7. 1169471Species Bacillus subtilis [TaxId:1423] [188552] (2 PDB entries)
  8. 1169474Domain d3c73b_: 3c73 B: [173063]
    automated match to d1su9a_
    complexed with so4

Details for d3c73b_

PDB Entry: 3c73 (more details), 2.5 Å

PDB Description: structure of cehc variant resa
PDB Compounds: (B:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d3c73b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c73b_ c.47.1.10 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwcehckkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpget

SCOPe Domain Coordinates for d3c73b_:

Click to download the PDB-style file with coordinates for d3c73b_.
(The format of our PDB-style files is described here.)

Timeline for d3c73b_: