Lineage for d3c3ya_ (3c3y A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 999459Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 999478Protein automated matches [190251] (3 species)
    not a true protein
  7. 999484Species Mesembryanthemum crystallinum [TaxId:3544] [188404] (1 PDB entry)
  8. 999485Domain d3c3ya_: 3c3y A: [173030]
    automated match to d1suia1
    complexed with ca, sah

Details for d3c3ya_

PDB Entry: 3c3y (more details), 1.37 Å

PDB Description: Crystal Structure of PFOMT, Phenylpropanoid and Flavonoid O-methyltransferase from M. crystallinum
PDB Compounds: (A:) O-methyltransferase

SCOPe Domain Sequences for d3c3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3ya_ c.66.1.1 (A:) automated matches {Mesembryanthemum crystallinum [TaxId: 3544]}
gllqseelcqyilrtsvypreagflkelreaneshpdsymstsplagqlmsfvlklvnak
ktievgvftgysllltalsipddgkitaidfdreayeiglpfirkagvehkinfiesdam
laldnllqgqesegsydfgfvdadkpnyikyherlmklvkvggivaydntlwggtvaqpe
sevpdfmkenreavielnkllaadprieivhlplgdgitfcrrly

SCOPe Domain Coordinates for d3c3ya_:

Click to download the PDB-style file with coordinates for d3c3ya_.
(The format of our PDB-style files is described here.)

Timeline for d3c3ya_: