SCOP 1.67: Domain d1b7ty_: 1b7t Y:

Lineage for d1b7ty_ (1b7t Y:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (21 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Essential Chain [47524] (3 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (11 PDB entries)

8. Domain d1b7ty_: 1b7t Y: [17303]
   Other proteins in same PDB: d1b7ta1, d1b7ta4, d1b7tz_
   complexed with adp, ca, mg

Details for d1b7ty_

PDB Entry: 1b7t, 2.5 Å

PDB Description: myosin digested by papain

SCOP Domain Sequences for d1b7ty_:

Sequence; same for both SEQRES and ATOM records:

>d1b7ty_ a.39.1.5 (Y:) Myosin Essential Chain {Bay scallop (Aequipecten irradians)}
pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvkftamikg

Timeline for d1b7ty_:

• d1b7ty_ first appeared (with stable ids) in SCOP 1.55
  
• d1b7ty_ appears in SCOP 1.65
  
• d1b7ty_ appears in SCOP 1.69
  
• d1b7ty_ appears in the current release, SCOPe 2.08