Lineage for d3bz1u_ (3bz1 U:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272870Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1273066Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 1273073Protein automated matches [191005] (1 species)
    not a true protein
  7. 1273074Species Thermosynechococcus elongatus [TaxId:32046] [188750] (2 PDB entries)
  8. 1273076Domain d3bz1u_: 3bz1 U: [172951]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1v_, d3bz1z_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1u_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d3bz1u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1u_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d3bz1u_:

Click to download the PDB-style file with coordinates for d3bz1u_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1u_: