Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein automated matches [190113] (12 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:32046] [188751] (2 PDB entries) |
Domain d3bz1v_: 3bz1 V: [172952] Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1z_ automated match to d1mz4a_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1v_ a.3.1.1 (V:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwgggkvyy
Timeline for d3bz1v_: