Lineage for d2axtu1 (2axt U:37-134)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272870Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1273066Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 1273067Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 1273068Species Thermosynechococcus elongatus [TaxId:146786] [158541] (1 PDB entry)
    Uniprot Q9F1L5 37-134
  8. 1273069Domain d2axtu1: 2axt U:37-134 [144940]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtv1, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axtu1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d2axtu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]}
eelvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipg
lterqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d2axtu1:

Click to download the PDB-style file with coordinates for d2axtu1.
(The format of our PDB-style files is described here.)

Timeline for d2axtu1: