SCOPe 2.01: Domain d3bqpb_: 3bqp B:

Lineage for d3bqpb_ (3bqp B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.0: automated matches [191532] (1 protein)
   not a true family

6. Protein automated matches [190901] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188335] (1 PDB entry)

8. Domain d3bqpb_: 3bqp B: [172789]
   automated match to d2gtga1
   complexed with mg

Details for d3bqpb_

PDB Entry: 3bqp, 1.3 Å

PDB Description: Crystal Structure of Human Saposin D (orthorhombic)

PDB Compounds: (B:) Proactivator polypeptide

SCOPe Domain Sequences for d3bqpb_:

Sequence; same for both SEQRES and ATOM records:

>d3bqpb_ a.64.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dggfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlie
ilvevmdpsfvclkigacps

Timeline for d3bqpb_:

• d3bqpb_ is new in SCOPe 2.01-stable
  
• d3bqpb_ appears in SCOPe 2.02
  
• d3bqpb_ appears in the current release, SCOPe 2.08