Lineage for d3bqpb_ (3bqp B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2717038Family a.64.1.0: automated matches [191532] (1 protein)
    not a true family
  6. 2717039Protein automated matches [190901] (2 species)
    not a true protein
  7. 2717040Species Human (Homo sapiens) [TaxId:9606] [188335] (1 PDB entry)
  8. 2717042Domain d3bqpb_: 3bqp B: [172789]
    automated match to d2gtga1
    complexed with mg

Details for d3bqpb_

PDB Entry: 3bqp (more details), 1.3 Å

PDB Description: Crystal Structure of Human Saposin D (orthorhombic)
PDB Compounds: (B:) Proactivator polypeptide

SCOPe Domain Sequences for d3bqpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bqpb_ a.64.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dggfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlie
ilvevmdpsfvclkigacps

SCOPe Domain Coordinates for d3bqpb_:

Click to download the PDB-style file with coordinates for d3bqpb_.
(The format of our PDB-style files is described here.)

Timeline for d3bqpb_: