Lineage for d3bp9p_ (3bp9 P:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330931Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2330932Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2330933Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2330934Protein AKV capsid [116949] (2 species)
  7. 2330942Species Murine leukemia virus [TaxId:11786] [188334] (1 PDB entry)
  8. 2330958Domain d3bp9p_: 3bp9 P: [172756]
    automated match to d1u7ka_
    complexed with gol, ipa

Details for d3bp9p_

PDB Entry: 3bp9 (more details), 2.6 Å

PDB Description: Structure of B-tropic MLV capsid N-terminal domain
PDB Compounds: (P:) gag protein

SCOPe Domain Sequences for d3bp9p_:

Sequence, based on SEQRES records: (download)

>d3bp9p_ a.73.1.1 (P:) AKV capsid {Murine leukemia virus [TaxId: 11786]}
plrlggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdytttegrnhlvlyrq
lllaglqnagr

Sequence, based on observed residues (ATOM records): (download)

>d3bp9p_ a.73.1.1 (P:) AKV capsid {Murine leukemia virus [TaxId: 11786]}
plrlglqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllgtllt
geekqrvllearkavrtqlpnevdaafplerpdwdytttegrnhlvlyrqlllaglqnag
r

SCOPe Domain Coordinates for d3bp9p_:

Click to download the PDB-style file with coordinates for d3bp9p_.
(The format of our PDB-style files is described here.)

Timeline for d3bp9p_: