Lineage for d3bjke_ (3bjk E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187709Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2187816Protein automated matches [190155] (3 species)
    not a true protein
  7. 2187830Species Haemophilus influenzae [TaxId:71421] [188352] (2 PDB entries)
  8. 2187835Domain d3bjke_: 3bjk E: [172666]
    automated match to d1ylia1
    complexed with cit, edo; mutant

Details for d3bjke_

PDB Entry: 3bjk (more details), 1.9 Å

PDB Description: crystal structure of hi0827, a hexameric broad specificity acyl- coenzyme a thioesterase: the asp44ala mutant enzyme
PDB Compounds: (E:) Acyl-CoA thioester hydrolase HI0827

SCOPe Domain Sequences for d3bjke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjke_ d.38.1.1 (E:) automated matches {Haemophilus influenzae [TaxId: 71421]}
skgvlllrtlampsdtnangdifggwimsqmamggailakeiahgrvvtvavesmnfikp
isvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngrsr
tiprennqelekalaliseq

SCOPe Domain Coordinates for d3bjke_:

Click to download the PDB-style file with coordinates for d3bjke_.
(The format of our PDB-style files is described here.)

Timeline for d3bjke_: