SCOPe 2.06: Domain d3bjkd_: 3bjk D:

Lineage for d3bjkd_ (3bjk D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein automated matches [190155] (3 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:71421] [188352] (2 PDB entries)

8. Domain d3bjkd_: 3bjk D: [172665]
   automated match to d1ylia1
   complexed with cit, edo; mutant

Details for d3bjkd_

PDB Entry: 3bjk, 1.9 Å

PDB Description: crystal structure of hi0827, a hexameric broad specificity acyl- coenzyme a thioesterase: the asp44ala mutant enzyme

PDB Compounds: (D:) Acyl-CoA thioester hydrolase HI0827

SCOPe Domain Sequences for d3bjkd_:

Sequence; same for both SEQRES and ATOM records:

>d3bjkd_ d.38.1.1 (D:) automated matches {Haemophilus influenzae [TaxId: 71421]}
kgvlllrtlampsdtnangdifggwimsqmamggailakeiahgrvvtvavesmnfikpi
svgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngrsrt
iprennqelekalaliseq

Timeline for d3bjkd_:

• d3bjkd_ first appeared in SCOPe 2.01
  
• d3bjkd_ appears in SCOPe 2.05
  
• d3bjkd_ appears in SCOPe 2.07
  
• d3bjkd_ appears in the current release, SCOPe 2.08