SCOPe 2.02: Domain d3bcob_: 3bco B:

Lineage for d3bcob_ (3bco B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Seminal ribonucleasease [54086] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54087] (15 PDB entries)
   Uniprot P00669 27-150

8. Domain d3bcob_: 3bco B: [172541]
   automated match to d1y94a_

Details for d3bcob_

PDB Entry: 3bco, 2.25 Å

PDB Description: crystal structure of the swapped form of p19a/l28q/n67d bs-rnase

PDB Compounds: (B:) Seminal ribonuclease

SCOPe Domain Sequences for d3bcob_:

Sequence; same for both SEQRES and ATOM records:

>d3bcob_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnsassssnycnqmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Timeline for d3bcob_:

• d3bcob_ first appeared in SCOPe 2.01
  
• d3bcob_ appears in SCOPe 2.03
  
• d3bcob_ appears in the current release, SCOPe 2.08