PDB entry 3bco

View 3bco on RCSB PDB site
Description: Crystal Structure of The Swapped FOrm of P19A/L28Q/N67D BS-RNase
Class: hydrolase
Keywords: domain swapping, bovine seminal ribonuclease, non covalent dimer, antitumor activity, Allosteric enzyme, Endonuclease, Hydrolase, Secreted
Deposited on 2007-11-13, released 2008-02-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered (18)
      • engineered (27)
      • engineered (66)
    Domains in SCOPe 2.02: d3bcoa_
  • Chain 'B':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered (18)
      • engineered (27)
      • engineered (66)
    Domains in SCOPe 2.02: d3bcob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bcoA (A:)
    kesaaakferqhmdsgnsassssnycnqmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bcoB (B:)
    kesaaakferqhmdsgnsassssnycnqmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv