Lineage for d1a2xa_ (1a2x A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537713Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 537965Protein Troponin C [47503] (6 species)
  7. 538009Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries)
  8. 538013Domain d1a2xa_: 1a2x A: [17251]
    Other proteins in same PDB: d1a2xb_
    complexed with a 47 residue (1-47) fragment of troponin I
    complexed with ca

Details for d1a2xa_

PDB Entry: 1a2x (more details), 2.3 Å

PDB Description: complex of troponin c with a 47 residue (1-47) fragment of troponin i

SCOP Domain Sequences for d1a2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2xa_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus)}
dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelaecfrifdrnadgyidaeelaeifra
sgehvtdeeieslmkdgdknndgridfdeflkmmegvq

SCOP Domain Coordinates for d1a2xa_:

Click to download the PDB-style file with coordinates for d1a2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1a2xa_: