SCOPe 2.08: Domain d1a2xa_: 1a2x A:

Lineage for d1a2xa_ (1a2x A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries)

8. Domain d1a2xa_: 1a2x A: [17251]
   Other proteins in same PDB: d1a2xb_
   complexed with a 47 residue (1-47) fragment of troponin I
   complexed with ca

Details for d1a2xa_

PDB Entry: 1a2x, 2.3 Å

PDB Description: complex of troponin c with a 47 residue (1-47) fragment of troponin i

PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1a2xa_:

Sequence; same for both SEQRES and ATOM records:

>d1a2xa_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelaecfrifdrnadgyidaeelaeifra
sgehvtdeeieslmkdgdknndgridfdeflkmmegvq

Timeline for d1a2xa_:

• d1a2xa_ first appeared (with stable ids) in SCOP 1.55
  
• d1a2xa_ appears in SCOPe 2.07