Lineage for d1a2xa_ (1a2x A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Troponin C [47503] (5 species) 
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries) 
Domain d1a2xa_: 1a2x A: [17251]
Other proteins in same PDB: d1a2xb_
Details for d1a2xa_
PDB Entry: 1a2x (more details), 2.3 Å
PDB Description: complex of troponin c with a 47 residue (1-47) fragment of troponin i
SCOP Domain Sequences for d1a2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2xa_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus)}
dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelaecfrifdrnadgyidaeelaeifra
sgehvtdeeieslmkdgdknndgridfdeflkmmegvq
SCOP Domain Coordinates for d1a2xa_:
Click to download the PDB-style file with coordinates for d1a2xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a2xa_:
- d1a2xa_ appears in SCOP 1.57
- d1a2xa_ appears in the current release, SCOPe 2.08
View in 3D
