| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Troponin C [47503] (6 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries) Uniprot P09860 |
| Domain d1tnqa_: 1tnq A: [17245] N-domain only complexed with ca |
PDB Entry: 1tnq (more details)
SCOPe Domain Sequences for d1tnqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tnqa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda
Timeline for d1tnqa_: