Lineage for d1tnqa_ (1tnq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711123Protein Troponin C [47503] (6 species)
  7. 2711124Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 2711153Domain d1tnqa_: 1tnq A: [17245]
    N-domain only
    complexed with ca

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1tnqa_

PDB Entry: 1tnq (more details)

PDB Description: structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
PDB Compounds: (A:) troponin-c

SCOPe Domain Sequences for d1tnqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnqa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda

SCOPe Domain Coordinates for d1tnqa_:

Click to download the PDB-style file with coordinates for d1tnqa_.
(The format of our PDB-style files is described here.)

Timeline for d1tnqa_: